PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07733
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 439aa    MW: 46946 Da    PI: 7.0104
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07733genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-32150206259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkve+s  +++++ei+Y+g+Hnh 
  EMT07733 150 DDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVETSL-EGQITEIVYKGTHNHA 206
               8****************************************.***************6 PP

2WRKY105.43.1e-33314372159
               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  EMT07733 314 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASHDLRAVITTYEGKHNHD 372
               59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-27141206IPR003657WRKY domain
SuperFamilySSF1182902.35E-24143207IPR003657WRKY domain
PROSITE profilePS5081120.908144208IPR003657WRKY domain
SMARTSM007744.1E-34149207IPR003657WRKY domain
PfamPF031061.3E-24150205IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.9E-37299374IPR003657WRKY domain
SuperFamilySSF1182901.7E-29306374IPR003657WRKY domain
PROSITE profilePS5081138.411309374IPR003657WRKY domain
SMARTSM007742.1E-38314373IPR003657WRKY domain
PfamPF031061.8E-25315372IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MNLADFLDSP VLLTSSIFPS PTTGAFGSQF NWRPEAPTPS AAEQGGKEEQ RQPYSDFSFQ  60
TAPANTEEAA RATTTSLQPP VAVASQGEEA YTGQQPPQQQ AWGYGQQQEG MDASASNPAS  120
FSAPALQATS SEMAPAGAYR QTHSQRRSSD DGYNWRKYGQ KQVKGSENPR SYYKCTFPNC  180
PTKKKVETSL EGQITEIVYK GTHNHAHTPA KPLNTRRGSG GGAAAAQVLQ SGGDASENSF  240
GAIVTTPENS SASFGDDDNN GVSSPRAGND NDDDEPDSKR RKDGGDGEGI NMAGNRTVRE  300
PRVVVQTMSD IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TTVGCPVRKH VERASHDLRA  360
VITTYEGKHN HDVPAARGSA ALYRPAPRAA DSTASTGHYL NPQPSAMAYQ TSTGGPNVAA  420
AGTQQYAPRP DGFGGQNQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-36141375878Probable WRKY transcription factor 4
1wj2_A2e-36141375878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3576710.0AK357671.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1058P10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564512.10.0PREDICTED: probable WRKY transcription factor 33
SwissprotQ8S8P52e-96WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLM8BXQ80.0M8BXQ8_AEGTA; Putative WRKY transcription factor 33
STRINGMLOC_67851.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29923687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.15e-96WRKY DNA-binding protein 33